PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2742880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 338aa    MW: 37647.2 Da    PI: 4.4606
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2742880.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.72.4e-4931311129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l pGfrFhP d elv++yLk+kv g+kl+  +vi+ev++yk+ PwdLp k ++++++ ewyfFs+++kky +g r nrat+ g+Wk tgkd++v
  Lj4g3v2742880.1   3 LVPGFRFHPMDVELVKFYLKRKVMGRKLPH-DVIAEVNVYKHAPWDLPdKsCLRTGDLEWYFFSPTEKKYGSGARMNRATEIGFWKVTGKDRAV 95 
                      579**************************9.99**************96347788999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      l+ ++++vg++ktL+f++g+ap+g +t+Wvmheyrle
  Lj4g3v2742880.1  96 LH-NNQVVGMRKTLIFHTGKAPRGDRTNWVMHEYRLE 131
                      **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-592153IPR003441NAC domain
PROSITE profilePS5100555.5163153IPR003441NAC domain
PfamPF023654.4E-255130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MKLVPGFRFH PMDVELVKFY LKRKVMGRKL PHDVIAEVNV YKHAPWDLPD KSCLRTGDLE  60
WYFFSPTEKK YGSGARMNRA TEIGFWKVTG KDRAVLHNNQ VVGMRKTLIF HTGKAPRGDR  120
TNWVMHEYRL EDKDLADKGI AQDSYVICKV FQKEGPGPRN GAQYGRPFNE EDWNDEEIGI  180
PYVDSSAPIP ISSITSNTSV PNDQYLLAGG CTGSTSTSCL TGMMPSPGLE IPSPPSNQAV  240
NSDEDILSML DIFKEDTLPE ENITEGAPSI DFFEDLGNLD SWDAAGFSSV QNVECGTNGM  300
ATTGDVSGFG DLDFLELIDL DSPLFWQTTL PENWSPDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-46115413169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.64220.0floral bud| flower| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0075110.0AP007511.2 Lotus japonicus genomic DNA, chromosome 4, clone: LjT25M06, TM0680, complete sequence.
GenBankAP0105040.0AP010504.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT20M06, TM1747, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572255.11e-145PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 78-like
TrEMBLA0A151TLE21e-156A0A151TLE2_CAJCA; NAC domain-containing protein 78
STRINGGLYMA08G16630.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.42e-86NAC domain containing protein 82